HORDB

ID: hor006473
Uniprot ID: Q8MJ25
Protein name: Glucagon-like peptide 2
Gene name: GCG
Organism: Ovis aries (Sheep)
Family: Glucagon family
Source: Animal
Expression: Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity). |Glucagon is secreted in the A cells of the islets of Langerhans. GLP-
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0014823 response to activity; GO:0042593 glucose homeostasis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: HADGSFSDEMNTVLDSLATRDFINWLLQTKI
Length: 31(146-176)
Propeptide: MKSLYFVAGLLVMLAQGSWQHSLQNTEEKSSSFPAPQTDPLGDPDQISEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVNIVEELRRRHADGSFSDEMNTVLDSLATRDFINWLLQTKI
Signal peptide: MKSLYFVAGLLVMLAQGSWQ
Modification: T5 Phosphoserine;T7 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
Mechanism: GLP-2 does not have cleavage on a pair of basic residues at C-terminus as in other mammals.
Cross BBB: NA
Target: GLP1R, GLP2R
Target Unid: W5Q4G0, W5P226
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006473_AF2.pdb

hor006473_ESM.pdb

Mass:	407424	Formula:	C156H241N41O51S
Absent amino acids:	CPY	Common amino acids:	DL
pI:	4.19	Basic residues:	3
Polar residues:	9	Hydrophobic residues:	12
Hydrophobicity:	-19.03	Boman Index:	-5479
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	91.29
Instability Index:	1639.35	Extinction Coefficient cystines:	5500
Absorbance 280nm:	183.33